FSHB polyclonal antibody
Produktgrößen
100 ug
£562,00
PAB8953-100UG
Über dieses Produkt
- SKU:
- PAB8953
- Anwendung:
- Dot Blot, ELISA, Immunohistochemistry
- Klonalität:
- Polyclonal
- Weitere Details:
- Rabbit polyclonal antibody raised against synthetic peptide of FSHB.
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to amino acids 47-84 of human FSHB.
- Physischer Zustand:
- Liquid
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- IQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCH
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- Abnova
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:PAB8953