Exendin-4 polyclonal antibody
Produktgrößen
150 ug
£432,00
PAB5186-150UG
Über dieses Produkt
- SKU:
- PAB5186
- Anwendung:
- ELISA, Immunoprecipitation
- Klonalität:
- Polyclonal
- Weitere Details:
- Rabbit polyclonal antibody raised against synthetic peptide of exendin-4.
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide (conjugated with KLH) corresponding to exendin-4.
- Isotyp:
- IgG
- Physischer Zustand:
- Liquid
- Sequenz:
- HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- Abnova
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:PAB5186