ABCB1 polyclonal antibody
Produktgrößen
100 ug
£562,00
PAB29562-100UG
Über dieses Produkt
- SKU:
- PAB29562
- Anwendung:
- IHC-Frozen, IHC-Paraffin
- Klonalität:
- Polyclonal
- Weitere Details:
- Rabbit polyclonal antibody raised against partial synthetic protein of human ABCB1.
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to amino acids 621-650 at internal region of human ABCB1.
- Isotyp:
- IgG
- Physischer Zustand:
- Lyophilized
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- IYFKLVTMQTAGNEVELENAADESKSEIDA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- Please refer to datasheet
- Hersteller:
- Abnova
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:PAB29562