CHN2 polyclonal antibody
Produktgrößen
100 ul
£697,00
PAB21183-100UL
Über dieses Produkt
- SKU:
- PAB21183
- Anwendung:
- IHC-Paraffin, Immunohistochemistry
- Klonalität:
- Polyclonal
- Weitere Details:
- Rabbit polyclonal antibody raised against recombinant CHN2.
- Host:
- Rabbit
- Immunogen:
- Recombinant protein corresponding to amino acids of human CHN2.
- Isotyp:
- IgG
- Physischer Zustand:
- Liquid
- Reaktivitäten:
- Human
- Sequenz:
- ASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKY
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Aliquot. Avoid freeze/thaw cycles., -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- Abnova
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:PAB21183