Erc2 polyclonal antibody
Produktgrößen
100 ug
£697,00
PAB15701-100UG
Über dieses Produkt
- SKU:
- PAB15701
- Anwendung:
- Immunohistochemistry
- Klonalität:
- Polyclonal
- Weitere Details:
- Rabbit polyclonal antibody raised against partial recombinant mouse Erc2.
- Host:
- Rabbit
- Immunogen:
- Recombinant GST fusion protein corresponding to 153 mouse Erc2.
- Physischer Zustand:
- Liquid
- Reaktivitäten:
- Mouse
- Sequenz:
- LMNALEKTRQELDATKARLASTQQSLAEKEAHLANLRIERRKQLEEILEMKQEALLAAISEKDANIALLELSASKKKKTQEEVMALKREKDRLVHQLKQQTQNRMKLMADNYDEDHHHYHHHHHHHHHRSPGRSQHSNHRPSPDQDDEEGIWA
- Versandbedingungen:
- Blue Ice
- Spezifität:
- Specific to recombinant protein GX0090. This antibody detects endogenous mERC2 protein in cerebellar purkinje cells.
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- Abnova
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:PAB15701