ABCC1 monoclonal antibody, clone IU5C1
Produktgrößen
100 ul
£697,00
MAB2374-100UL
Über dieses Produkt
- SKU:
- MAB2374
- Anwendung:
- Immunofluorescence, Western Blot
- translate.label.attr.clone:
- IU5C1
- Klonalität:
- Monoclonal
- Weitere Details:
- Mouse monoclonal antibody raised against synthetic peptide of ABCC1.
- Host:
- Mouse
- Immunogen:
- A synthetic peptide corresponding to amino acids 1-33 of human ABCC1.
- Isotyp:
- IgG1
- Physischer Zustand:
- Liquid
- Reaktivitäten:
- Human, Mouse
- Sequenz:
- SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- Abnova
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:MAB2374