Atxn1 monoclonal antibody, clone S76-8 (Biotin)
Produktgrößen
100 ug
£836,00
MAB16868-100UG
Über dieses Produkt
- SKU:
- MAB16868
- Anwendung:
- IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Western Blot
- translate.label.attr.clone:
- S76-8
- Klonalität:
- Monoclonal
- Konjugat:
- Biotin
- Weitere Details:
- Mouse monoclonal antibody raised against synthetic peptide of mouse Atxn1.
- Host:
- Mouse
- Immunogen:
- A synthetic peptide corresponding to amino acids 164-197 of mouse Atxn1.
- Isotyp:
- IgG2b
- Physischer Zustand:
- Liquid
- Reaktivitäten:
- Human, Mouse
- Sequenz:
- ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C
- Hersteller:
- Abnova
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:MAB16868