Abcc9 monoclonal antibody, clone S319A-14 (Biotin)
Produktgrößen
100 ug
£836,00
MAB16841-100UG
Über dieses Produkt
- SKU:
- MAB16841
- Anwendung:
- IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Western Blot
- translate.label.attr.clone:
- S319A-14
- Klonalität:
- Monoclonal
- Konjugat:
- Biotin
- Weitere Details:
- Mouse monoclonal antibody raised against partial recombinant mouse Abcc9.
- Host:
- Mouse
- Immunogen:
- Recombinant protein corresponding to amino acids 1505-1546 at C-terminus of mouse Abcc9.
- Isotyp:
- IgG2a
- Physischer Zustand:
- Liquid
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- Abnova
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:MAB16841