FOXQ1 monoclonal antibody (M25C), clone 3C1
Produktgrößen
200 ul
£333,00
H00094234-M25C-200UL
Über dieses Produkt
- SKU:
- H00094234-M25C
- Zusätzliche Namen:
- CXGrade
- Anwendung:
- ELISA, Western Blot
- translate.label.attr.clone:
- 3C1
- Klonalität:
- Monoclonal
- Weitere Details:
- Mouse monoclonal antibody raised against a partial recombinant FOXQ1. This product is belong to Cell Culture Grade Antibody (CX Grade).
- Host:
- Mouse
- Immunogen:
- FOXQ1 (NP_150285.3, 133 a.a. ~ 223 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotyp:
- IgG2b, kappa
- Reaktivitäten:
- Human
- Sequenz:
- RDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHRAPVP
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- Abnova
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:H00094234-M25C