C11orf30 monoclonal antibody (M01), clone 5D1
Produktgrößen
100 ug
£333,00
H00056946-M01-100UG
Über dieses Produkt
- SKU:
- H00056946-M01
- Anwendung:
- ELISA, Immunofluorescence, Western Blot
- translate.label.attr.clone:
- 5D1
- Klonalität:
- Monoclonal
- Weitere Details:
- Mouse monoclonal antibody raised against a partial recombinant C11orf30.
- Host:
- Mouse
- Immunogen:
- C11orf30 (NP_064578, 1081 a.a. ~ 1178 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotyp:
- IgG3, kappa
- Reaktivitäten:
- Human
- Sequenz:
- PASSEKQTASQVEQPIITQGSSVTKITFEGRQPPTVTKITGGSSVPKLTSPVTSISPIQASEKTAVSDILKMSLMEAQIDTNVEHMIVDPPKKALATS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- Abnova
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:H00056946-M01