CSNK1G1 monoclonal antibody (M02), clone 2E10
Produktgrößen
100 ug
£333,00
H00053944-M02-100UG
Über dieses Produkt
- SKU:
- H00053944-M02
- Anwendung:
- ELISA, IHC-Paraffin, Western Blot
- translate.label.attr.clone:
- 2E10
- Klonalität:
- Monoclonal
- Weitere Details:
- Mouse monoclonal antibody raised against a partial recombinant CSNK1G1.
- Host:
- Mouse
- Immunogen:
- CSNK1G1 (AAH17236, 293 a.a. ~ 393 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotyp:
- IgG3, kappa
- Reaktivitäten:
- Human
- Sequenz:
- KKGYTFDYAYDWVGRPIPTPVGSVHVDSGASAITRESHTHRDRPSQQQPLRNQVVSSTNGELNVDDPTGAHSNAPITAHAEVEVVEEAKCCCFFKRKRKKT
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- Abnova
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:H00053944-M02