ANAPC11 monoclonal antibody (M01), clone 1B4-1A4
Produktgrößen
100 ug
£333,00
H00051529-M01-100UG
Über dieses Produkt
- SKU:
- H00051529-M01
- Anwendung:
- ELISA, Proximity Ligation Assay, Western Blot
- translate.label.attr.clone:
- 1B4-1A4
- Klonalität:
- Monoclonal
- Weitere Details:
- Mouse monoclonal antibody raised against a full length recombinant ANAPC11.
- Host:
- Mouse
- Immunogen:
- ANAPC11 (AAH00607, 1 a.a. ~ 54 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotyp:
- IgG1, kappa
- Reaktivitäten:
- Human
- Sequenz:
- MGPGPVGKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- Abnova
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:H00051529-M01