CRSP8 monoclonal antibody (M01), clone 8B8
Produktgrößen
50 ug
£333,00
H00009442-M01-50UG
Über dieses Produkt
- SKU:
- H00009442-M01
- Anwendung:
- ELISA, IHC-Paraffin, Western Blot
- translate.label.attr.clone:
- 8B8
- Klonalität:
- Monoclonal
- Weitere Details:
- Mouse monoclonal antibody raised against a full length recombinant CRSP8.
- Host:
- Mouse
- Immunogen:
- CRSP8 (AAH02878, 1 a.a. ~ 70 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotyp:
- IgG1, kappa
- Reaktivitäten:
- Human
- Sequenz:
- MRNKETLEGREKAFIAHFQDNLHSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLL
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- Abnova
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:H00009442-M01