GBA monoclonal antibody (M01J), clone 2E2
Produktgrößen
100 ug
£494,00
H00002629-M01J-100UG
Über dieses Produkt
- SKU:
- H00002629-M01J
- Zusätzliche Namen:
- CXGrade
- Anwendung:
- ELISA, IHC-Paraffin, Immunofluorescence, Western Blot
- translate.label.attr.clone:
- 200
- Klonalität:
- Monoclonal
- Weitere Details:
- Mouse monoclonal antibody raised against a partial recombinant GBA. This product is belong to Cell Culture Grade Antibody (CX Grade).
- Host:
- Mouse
- Immunogen:
- GBA (NP_000148.2, 146 a.a. ~ 235 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotyp:
- IgG2a, kappa
- Reaktivitäten:
- Human
- Sequenz:
- SYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAVNGKGS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- Abnova
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:H00002629-M01J