FRZB monoclonal antibody (M05), clone 1H8
Produktgrößen
100 ug
£333,00
H00002487-M05-100UG
Über dieses Produkt
- SKU:
- H00002487-M05
- Anwendung:
- ELISA, Western Blot
- translate.label.attr.clone:
- 1H8
- Klonalität:
- Monoclonal
- Weitere Details:
- Mouse monoclonal antibody raised against a full length recombinant FRZB.
- Host:
- Mouse
- Immunogen:
- FRZB (NP_001454, 102 a.a. ~ 190 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotyp:
- IgG2a, kappa
- Reaktivitäten:
- Human
- Sequenz:
- HEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTY*
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- Abnova
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:H00002487-M05