ERBB2 monoclonal antibody (M04), clone 4E1
Produktgrößen
100 ug
£333,00
H00002064-M04-100UG
Über dieses Produkt
- SKU:
- H00002064-M04
- Anwendung:
- ELISA, IHC-Paraffin, Immunofluorescence, Western Blot
- translate.label.attr.clone:
- 4E1
- Klonalität:
- Monoclonal
- Weitere Details:
- Mouse monoclonal antibody raised against a partial recombinant ERBB2.
- Host:
- Mouse
- Immunogen:
- ERBB2 (NP_004439, 22 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotyp:
- IgG2b, kappa
- Reaktivitäten:
- Human
- Sequenz:
- STQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGD
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- Abnova
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:H00002064-M04