ELF4 monoclonal antibody (M02), clone 1E10
Produktgrößen
100 ug
£333,00
H00002000-M02-100UG
Über dieses Produkt
- SKU:
- H00002000-M02
- Anwendung:
- ELISA, Western Blot
- translate.label.attr.clone:
- 1E10
- Klonalität:
- Monoclonal
- Weitere Details:
- Mouse monoclonal antibody raised against a partial recombinant ELF4.
- Host:
- Mouse
- Immunogen:
- ELF4 (NP_001412, 521 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotyp:
- IgG1, lambda
- Reaktivitäten:
- Human
- Sequenz:
- IAAFIRTSGTTAAPRVKEGPLRSSSYVQGMVTGAPMEGLLVPEETLRELLRDQAHLQPLPTQVVSRGSHNPSLLGNQTLSPPSRPTVGLTPV
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- Abnova
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:H00002000-M02