EIF2S3 monoclonal antibody (M01), clone 2C9
Produktgrößen
100 ug
£333,00
H00001968-M01-100UG
Über dieses Produkt
- SKU:
- H00001968-M01
- Anwendung:
- ELISA, Immunofluorescence, Western Blot
- translate.label.attr.clone:
- 2C9
- Klonalität:
- Monoclonal
- Weitere Details:
- Mouse monoclonal antibody raised against a partial recombinant EIF2S3.
- Host:
- Mouse
- Immunogen:
- EIF2S3 (NP_001406, 383 a.a. ~ 472 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotyp:
- IgG2a, kappa
- Reaktivitäten:
- Human
- Sequenz:
- GVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- Abnova
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:H00001968-M01