DLX1 monoclonal antibody (M15), clone 4B7
Produktgrößen
100 ug
£333,00
H00001745-M15-100UG
Über dieses Produkt
- SKU:
- H00001745-M15
- Anwendung:
- ELISA, Western Blot
- translate.label.attr.clone:
- 4B7
- Klonalität:
- Monoclonal
- Weitere Details:
- Mouse monoclonal antibody raised against a full length recombinant DLX1.
- Host:
- Mouse
- Immunogen:
- DLX1 (NP_835221, 181 a.a. ~ 254 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotyp:
- IgG2a, kappa
- Reaktivitäten:
- Human, Mouse
- Sequenz:
- SKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAGSYIPSYTSWYPSAHQEAMQQPQL*
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- Abnova
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:H00001745-M15