COL9A3 monoclonal antibody (M02A), clone 2B5
Produktgrößen
200 ul
£333,00
H00001299-M02A-200UL
Über dieses Produkt
- SKU:
- H00001299-M02A
- Anwendung:
- ELISA, Western Blot
- translate.label.attr.clone:
- 2B5
- Klonalität:
- Monoclonal
- Weitere Details:
- Mouse monoclonal antibody raised against a partial recombinant COL9A3.
- Host:
- Mouse
- Immunogen:
- COL9A3 (NP_001844, 280 a.a. ~ 338 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotyp:
- IgM, kappa
- Reaktivitäten:
- Human
- Sequenz:
- GDLGRPGPKGTPGVAGPSGEPGMPGKDGQNGVPGLDGQKGEAGRNGAPGEKGPNGLPGL
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- Abnova
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:H00001299-M02A