CDX4 monoclonal antibody (M11), clone 2H7
Produktgrößen
100 ug
£333,00
H00001046-M11-100UG
Über dieses Produkt
- SKU:
- H00001046-M11
- Anwendung:
- ELISA, Western Blot
- translate.label.attr.clone:
- 2H7
- Klonalität:
- Monoclonal
- Weitere Details:
- Mouse monoclonal antibody raised against a full length recombinant CDX4.
- Host:
- Mouse
- Immunogen:
- CDX4 (NP_005184, 202 a.a. ~ 284 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotyp:
- IgG2a, kappa
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- RKSELAVNLGLSERQVKIWFQNRRAKERKMIKKKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVSE*
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- Abnova
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:H00001046-M11