CDH6 monoclonal antibody (M05), clone 2F2
Produktgrößen
100 ug
£333,00
H00001004-M05-100UG
Über dieses Produkt
- SKU:
- H00001004-M05
- Anwendung:
- ELISA, Western Blot
- translate.label.attr.clone:
- 2F2
- Klonalität:
- Monoclonal
- Weitere Details:
- Mouse monoclonal antibody raised against a partial recombinant CDH6.
- Host:
- Mouse
- Immunogen:
- CDH6 (NP_004923, 513 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotyp:
- IgG1, kappa
- Reaktivitäten:
- Human
- Sequenz:
- DKDDPYSGHQFSFSLAPEAASGSNFTIQDNKDNTAGILTRKNGYNRHEMSTYLLPVVISDNDYPVQSSTGTVTVRVCACDHHGNMQSCHAEALIHPTGLS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- Abnova
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:H00001004-M05