BUB1B monoclonal antibody (M02J), clone 2G5
Produktgrößen
100 ug
£494,00
H00000701-M02J-100UG
Über dieses Produkt
- SKU:
- H00000701-M02J
- Zusätzliche Namen:
- CXGrade
- Anwendung:
- ELISA, IHC-Paraffin, Proximity Ligation Assay, Western Blot
- translate.label.attr.clone:
- 2G5
- Klonalität:
- Monoclonal
- Weitere Details:
- Mouse monoclonal antibody raised against a partial recombinant BUB1B. This product is belong to Cell Culture Grade Antibody (CX Grade).
- Host:
- Mouse
- Immunogen:
- BUB1B (AAH18739, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotyp:
- IgG1, kappa
- Reaktivitäten:
- Human
- Sequenz:
- MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMSTLQGALAQESACNNTLQQQKRAFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPRFLNLWLKLGR
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- Abnova
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:H00000701-M02J