APOA2 monoclonal antibody (M03), clone 1H6
Produktgrößen
100 ug
£333,00
H00000336-M03-100UG
Über dieses Produkt
- SKU:
- H00000336-M03
- Anwendung:
- ELISA, IHC-Paraffin, Immunofluorescence, Western Blot
- translate.label.attr.clone:
- 1H6
- Klonalität:
- Monoclonal
- Weitere Details:
- Mouse monoclonal antibody raised against a full-length recombinant APOA2.
- Host:
- Mouse
- Immunogen:
- APOA2 (AAH05282, 1 a.a. ~ 100 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotyp:
- IgG1, kappa
- Reaktivitäten:
- Human
- Sequenz:
- MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- Abnova
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:H00000336-M03