AMPD2 monoclonal antibody (M04A), clone 2G8
Produktgrößen
200 ul
£333,00
H00000271-M04A-200UL
Über dieses Produkt
- SKU:
- H00000271-M04A
- Anwendung:
- ELISA, Western Blot
- translate.label.attr.clone:
- 2G8
- Klonalität:
- Monoclonal
- Weitere Details:
- Mouse monoclonal antibody raised against a partial recombinant AMPD2.
- Host:
- Mouse
- Immunogen:
- AMPD2 (NP_631895, 86 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotyp:
- IgG2a, kappa
- Reaktivitäten:
- Human
- Sequenz:
- ISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRSLRERDVLEREFQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTT
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- Abnova
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:H00000271-M04A