Anti-Wnt7a Polyclonal Antibody
Produktgrößen
100 μg/vial
£785,00
39-2011-100UG
Über dieses Produkt
- SKU:
- 39-2011
- Zusätzliche Namen:
- Protein Wnt-7a; WNT7A
- Klonalität:
- Polyclonal
- Weitere Details:
- This gene is a member of the WNT gene family; which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes; including regulation of cell fate and patterning during embryogenesis. This gene is involved in the development of the anterior-posterior axis in the female reproductive tract; and also plays a critical role in uterine smooth muscle pattering and maintenance of adult uterine function. Mutations in this gene are associated with Fuhrmann and Al-Awadi / Raas €“ Rothschild / Schinzel phocomelia syndromes.
- Format:
- Lyophilized
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-terminus of Human Wnt7a (226-256aa YVLKDKYNEAVHVEPVRASRNKRPTFLKIKK); identical to the related Mouse sequence.
- Isotyp:
- Rabbit IgG
- Aufreinigung:
- Immunogen affinity purified.
- Reaktivitäten:
- Human, Mouse, Rat
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- At -20[o]C for one year. After reconstitution; at 4[o]C for one month. It can also be aliquotted and stored frozen at -20[o]C for a longer time. Avoid repeated freezing and thawing.
- Hersteller:
- Abeomics
- Typ:
- Antibodies:Polyclonal Antibody
- Datenblatt des Herstellers:1.jpg
