Anti-FABP4 Polyclonal Antibody
Produktgrößen
100 μg/vial
£785,00
39-2008-100UG
Über dieses Produkt
- SKU:
- 39-2008
- Zusätzliche Namen:
- Fatty acid-binding protein; adipocyte; Adipocyte lipid-binding protein; ALBP; Adipocyte-type fatty acid-binding protein; A-FABP; AFABP; Fatty acid-binding protein 4; FABP4
- Klonalität:
- Polyclonal
- Weitere Details:
- Fatty acid binding proteins (FABPs) are small cytoplasmic proteins that are expressed in a highly tissue-specific manner and bind to fatty acids such as oleic and retinoic acid. Adipocyte fatty-acid-binding protein; aP2 (FABP4) is expressed in adipocytes and macrophages; and integrates inflammatory and metabolic responses. Studies in aP2-deficient mice have shown that this lipid chaperone has a significant role in several aspects of metabolic syndrome; including type 2 diabetes and atherosclerosis. It regulates allergic airway inflammation and may provide a link between fatty acid metabolism and asthma.
- Format:
- Lyophilized
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the N-terminus of Human FABP4 (10-40aa KLVSSENFDDYMKEVGVGFATRKVAGMAKPN); identical to the related Mouse and Rat sequences.
- Isotyp:
- Rabbit IgG
- Aufreinigung:
- Immunogen affinity purified.
- Reaktivitäten:
- Mouse
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- At -20[o]C for one year. After reconstitution; at 4[o]C for one month. It can also be aliquotted and stored frozen at -20[o]C for a longer time. Avoid repeated freezing and thawing.
- Hersteller:
- Abeomics
- Typ:
- Antibodies:Polyclonal Antibody
- Datenblatt des Herstellers:1.jpg
