Monoclonal Antibody to DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker)(DG1/447 + DOG-1.1)
Produktgrößen
100 µg
£716,00
36-1582-100UG
Über dieses Produkt
- SKU:
- 36-1582
- Zusätzliche Namen:
- ANO1||DOG1||ORAOV2||TAOS2||TMEM16A
- translate.label.attr.clone:
- DG1/447 + DOG-1.1
- Klonalität:
- Monoclonal
- Weitere Details:
- Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs); c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors; which; due to appearance; may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs; including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs; including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%.
- Format:
- Purified
- Host:
- Mouse
- Immunogen:
- Recombinant human DOG-1 protein (DG1/447) + A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL); conjugated to a carrier protein (DOG-1.1).
- Isotyp:
- Mouse IgG1; kappa + Mouse IgG1; kappa
- Aufreinigung:
- Affinity Chromatography
- Reaktivitäten:
- Human
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- Store the antibody at 4[o]C; stable for 6 months. For long-term storage; store at -20[o]C. Avoid repeated freeze and thaw cycles.
- Hersteller:
- Abeomics
- Typ:
- Antibodies:Monoclonal Antibody
- Datenblatt des Herstellers:1.jpg