PLA2G10 Recombinant Protein
Produktgrößen
10 µg
£528,00
32-2676-10UG
Über dieses Produkt
- SKU:
- 32-2676
- Zusätzliche Namen:
- Group 10 secretory phospholipase A2||EC 3.1.1.4||Group X secretory phospholipase A2||Phosphatidylcholine 2-acylhydrolase GX||GX sPLA2||sPLA2-X||SPLA2||GXPLA2||MGC119918||MGC119919||MGC133367||PLA2G10.
- Weitere Details:
- Source : Escherichia Coli. Secreted Phospholipase A2-X Human Recombinant is manufactured with N-terminal fusion HisTag. PLA2G10 His-Tagged Fusion Protein; is 15.5 kDa containing 123 amino acid residues of the human secreted phospholipase A2-X and 16 additional amino acid residues - HisTag .MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD. Phospholipase A2 (PLA2) catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to liberate arachidonic acid (AA); a precursor of eicosanoids including prostaglandins and leukotrienes. The same reaction also produces lysophosholipids; which represent another class of lipid mediators.The secretory PLA2 (sPLA2) family; in which 10 isozymes have been identified; consists of low molecular weight; Ca2+-requiring secretory enzymes that have been implicated in a number of biological processes; such as modification of eicosanoid generation; inflammation; and host defense.This enzyme has been proposed to hydrolyze phosphatidylcholine (PC) in lipoproteins to liberate lyso-PC and free fatty acids in the arterial wall; thereby facilitating the accumulation of bioactive lipids and modified lipoproteins in atherosclerotic foci.In mice; sPLA2 expression significantly influences HDL particle size and composition and demonstrate that an induction of sPLA2 is required for the decrease in plasma HDL cholesterol in response to inflammatory stimuli. Instillation of bacteria into the bronchi was associated with surfactant degradation and a decrease in large:small ratio of surfactant aggregates in rats.
- Aufreinigung:
- Greater than 95% as determined by SDS PAGE.
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- Store lyophilized protein at -20[o]C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4[o]C for a limited period of time; it does not show any change after two weeks at 4[o]C.
- Hersteller:
- Abeomics
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules
- Datenblatt des Herstellers:1.jpg