Claudin18.2/HEK293 Stable Cell Line
Produktgrößen
1 Vial
£2747,00
14-541ACL-1VIAL
Über dieses Produkt
- SKU:
- 14-541ACL
- Weitere Details:
- Claudin 18.2/HEK293 Stable Cell Line is a stably transfected HEK293 cell line which expresses human claudin 18.2 (CLDN18.2). CLDN18.2 is a highly selective marker protein that is exclusively expressed in differentiated gastric mucosal membrane epithelial cells. Abnormal expression of CLDN18.2 has been observed during the occurence and development of various primary malignat tumors such as gastric cancer; breast cancer; colon cancer and liver cancer. CLDN18.2 has become a significant biomarker for targeted therapy in different cancers; and a monoclonal antibody against CLDN18.2 such as Anti-CLDN18.2 (zolbetuximab biosimilar; Abeomics; Cat. No.: 12-9134) is an example utilized in the immunotherapy targeting CLDN18.2. Sequence data: Human CLDN18.2 (accession number NP_001002026) MAVTACQGLGFVVSLIGIAGIIAATCMDQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGFTECRGYFTLLGLPAM LQAVRALMIVGIVLGAIGLLVSIFALKCIRIGSMEDSAKANMTLTSGIMFIVSGLCAIAGVSVFANMLVTNFWMSTA NMYTGMGGMVQTVQTRYTFGAALFVGWVAGGLTLIGGVMMCIACRGLAPEETNYKAVSYHASGHSVAYKPGG FKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDYV
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- Immediately upon receipt; store in liquid nitrogen.
- Hersteller:
- Abeomics
- Typ:
- Cells:Cell Lines
- Datenblatt des Herstellers:14-541ACL_HEK-CLDN18.2_F1.png