Skip to content

Warenkorb

Der Warenkorb ist leer.

Gesamt (exkl. MwSt.) £0,00
Warenkorb überprüfen & bezahlen

TLR2/HEK293 Stable Cell Line

Produktgrößen
1 Vial
£2747,00
14-531ACL-1VIAL
Über dieses Produkt
SKU:
14-531ACL
Weitere Details:
TLR2/HEK293 Stable Cell Line is a stably transfected HEK293 cell line which expresses human Toll-like receptor 2 (TLR2; also designated as CD282). TLR2 mediates immune responses by recognition of lipid-containing pathogen-associated molecular patterns (PAMPs) such as lipoteichoic acid and di- and tri-acylated cysteine-containing lipoproteins. TLR2 forms heterodimers with TLR1 or TLR6 as the initial step in a signal transduction cascade which leads to significant innate immune responses as well as development of adaptive immunity. TLR2-TLR1 heterodimers recognize triacylated lipopeptides from Gram-negative bacteria and mycoplasma; while TLR2-TLR6 heterodimers recognize diacylated lipopeptides from Gram-positive bacteria and mycoplasma. Note that TLR2 in the TLR2/HEK293 stable cell line contains the N-terminal HA tag (Figure 2); which does not interfere with TLR2 activity as confirmed by functional assay (Figure 1). Sequence data: Human TLR2 (accession number NP_001305716) MPHTLWMVWVLGVIISLSKEESSNQASLSCDRNGICKGSSGSLN SIPSGLTEAVKSLDLSNNRITYISNSDLQRCVNLQALVLTSNGINTIEEDSFSSLGSL EHLDLSYNYLSNLSSSWFKPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMD TFTKIQRKDFAGLTFLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFV DVTSSVECLELRDTDLDTFHFSELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQI SGLLELEFDDCTLNGVGNFRASDNDRVIDPGKVETLTIRRLHIPRFYLFYDLSTLYSL TERVKRITVENSKVFLVPCLLSQHLKSLEYLDLSENLMVEEYLKNSACEDAWPSLQTL ILRQNHLASLEKTGETLLTLKNLTNIDISKNSFHSMPETCQWPEKMKYLNLSSTRIHS VTGCIPKTLEILDVSNNNLNLFSLNLPQLKELYISRNKLMTLPDASLLPMLLVLKISR NAITTFSKEQLDSFHTLKTLEAGGNNFICSCEFLSFTQEQQALAKVLIDWPANYLCDS PSHVRGQQVQDVRLSVSECHRTALVSGMCCALFLLILLTGVLCHRFHGLWYMKMMWAW LQAKRKPRKAPSRNICYDAFVSYSERDAYWVENLMVQELENFNPPFKLCLHKRDFIPG KWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKYELDFSHFRLFDENNDAAILILLEPI EKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS
Versandbedingungen:
Blue Ice
Lagerbedingungen:
Immediately upon receipt; store in liquid nitrogen.
Hersteller:
Abeomics
Typ:
Cells:Cell Lines
Fig-2: Western blot analysis of TLR2 expression in the TLR2/HEK293 cell line. Cell lysates were analyzed by SDS-PAGE followed by Western blotting using anti-HA antibody. Note that TLR2 in the TLR2/HEK293 stable cell line contains the N-terminal HA tag. Control; parental HEK293 cell lysate; TLR2; TLR2/HEK293 cell lysate.
Fig-2: Western blot analysis of TLR2 expression in the TLR2/HEK293 cell line. Cell lysates were analyzed by SDS-PAGE followed by Western blotting using anti-HA antibody. Note that TLR2 in the TLR2/HEK293 stable cell line contains the N-terminal HA tag. Control; parental HEK293 cell lysate; TLR2; TLR2/HEK293 cell lysate.