Recombinant Mouse IgG2C Protein
Produktgrößen
100 ug
£276,00
RPT0024-100UG
500 ug
£764,00
RPT0024-500UG
1000 ug
£1193,00
RPT0024-1000UG
Über dieses Produkt
- SKU:
- RPT0024
- Zusätzliche Namen:
- Immunoglobulin heavy constant gamma 2C ,Ighg2c
- Weitere Details:
- Mouse IgG2c is a subclass of mouse antibody IgG, it can bind FcG GammaRIV with high affinity and the Fc loop residues of mouse IgG2c promote greater receptor-binding affinity than mouse IgG2b or human IgG1.
- Formulierung:
- Recombinant Recombinant Mouse IgG2C Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu98-Lys335) of Mouse IgG2C fused with His tag at the N-termi
- Immunogen:
- Glu98-Lys335
- Molekulargewicht:
- 30-35 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- ESRRPIPPNSCPPCKECSIFPAPDLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNRALPSPIEKTISKPRGPVRAPQVYVLPPPAEEMTKKEFSLTCMITDFLPAEIAVDWTSNGHKELNYKNTAPVLDTDGSYFMYSKLRVQKSTWEKGSLFACSVVHEGLHNHHTTKTISRSLGK
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Isotype Controls
- Datenblatt des Herstellers:RPT0024