Recombinant Human IgA1 Protein
Produktgrößen
100 ug
£205,00
RPT0023-100UG
500 ug
£526,00
RPT0023-500UG
1000 ug
£812,00
RPT0023-1000UG
Über dieses Produkt
- SKU:
- RPT0023
- Zusätzliche Namen:
- Immunoglobulin heavy constant alpha 1,Ig alpha-1 chain C region,Ig alpha-1 chain C region BUR,Ig alpha-1 chain C region TRO ,IGHA1 ,IgA1
- Weitere Details:
- Recombinant Human IgA1 Protein , Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens . The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen .
- Formulierung:
- Recombinant Recombinant Human IgA1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Cys122-Tyr353) of Human IgA1 (Accession #P01876-1) fused with H
- Immunogen:
- Cys122-Tyr353
- Molekulargewicht:
- 30-40 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- CCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLADWQMPPPYVVLDLPQETLEE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Isotype Controls
- Datenblatt des Herstellers:RPT0023