Recombinant Mouse IgG1 Protein
Produktgrößen
50 ug
£145,00
RPT0017-50UG
100 ug
£193,00
RPT0017-100UG
500 ug
£526,00
RPT0017-500UG
1000 ug
£812,00
RPT0017-1000UG
Über dieses Produkt
- SKU:
- RPT0017
- Zusätzliche Namen:
- IgG1,Ighg1,Igh-4,Ig gamma-1 chain C region secreted form
- Weitere Details:
- As a monomeric immunoglobulin that is predominately involved in the secondary antibody response and the only isotype that can pass through the human placenta, Immunoglobulin G (IgG) is synthesized and secreted by plasma B cells, and constitutes 75% of serum immunoglobulins in humans. IgG antibodies protect the body against the pathogens by agglutination and immobilization, complement activation, toxin neutralization, as well as antibody-dependent cell-mediated cytotoxicity (ADCC). IgG tetramer contains two heavy chains (5 kDa ) and two light chains (25 kDa) linked by disulfide bonds, that is the two identical halves form the Y-like shape. IgG is digested by pepsin proteolysis into Fab fragment (antigen-binding fragment) and Fc fragment ("crystallizable" fragment). IgG1 is most abundant in serum among the four IgG subclasses (IgG1, 2, 3 and 4) and binds to Fc receptors (FcG GammaR ) on phagocytic cells with high affinity.
- Formulierung:
- Recombinant Mouse IgG1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence Val98-Lys324 of MouseIgG1(Accession #P01868-1) fused with no tag.
- Immunogen:
- Val98-Lys324
- Molekulargewicht:
- 30-40 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- PRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMNTNGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Isotype Controls
- Datenblatt des Herstellers:RPT0017