Recombinant Human IgE Protein
Produktgrößen
20 ug
£145,00
RPT0015-20UG
50 ug
£193,00
RPT0015-50UG
100 ug
£276,00
RPT0015-100UG
500 ug
£764,00
RPT0015-500UG
1000 ug
£1193,00
RPT0015-1000UG
Über dieses Produkt
- SKU:
- RPT0015
- Zusätzliche Namen:
- Immunoglobulin heavy constant epsilon, Ig epsilon chain C region, Ig epsilon chain C region ND, IGHE, IgE
- Weitere Details:
- Predicted to enable antigen binding activity and immunoglobulin receptor binding activity. Predicted to be involved in several processes, including activation of immune response; defense response to other organism; and phagocytosis. Predicted to be located in extracellular region. Predicted to be part of immunoglobulin complex, circulating. Predicted to be active in external side of plasma membrane.
- Formulierung:
- Recombinant Human IgE Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser106-Gly427) of Human IgE (Accession #AAB59395.1 ) fused with a His tag a
- Immunogen:
- Ser106-Gly427
- Molekulargewicht:
- 45-60 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- SRDFTPPTVKILQSSCDGGGHFPPTIQLLCLVSGYTPGTINITWLEDGQVMDVDLSTASTTQEGELASTQSELTLSQKHWLSDRTYTCQVTYQGHTFEDSTKKCADSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNPG
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Isotype Controls
- Datenblatt des Herstellers:RPT0015