Recombinant Mouse IgE Protein
Produktgrößen
50 ug
£193,00
RPT0013-50UG
100 ug
£276,00
RPT0013-100UG
500 ug
£764,00
RPT0013-500UG
1000 ug
£1193,00
RPT0013-1000UG
Über dieses Produkt
- SKU:
- RPT0013
- Zusätzliche Namen:
- IgE,Ig epsilon chain C region,Immunoglobulin heavy constant epsilon
- Weitere Details:
- As one of the five designated immunoglobulin isotypes, immunoglobulin E (IgE) plays a major role in atopic conditions by inducing immediate hypersensitivity reactions. IgE also contributes significantly to the body's immune response to parasitic infections. IgE antibodies are predominantly found in the tissues, firmly attached to effector cells, such as mast cells and basophils, by high-affinity IgE Fc receptor (Fc epsilon RI) and low-affinity IgE receptor (Fc epsilon RII).
- Formulierung:
- Recombinant Mouse IgE Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Pro50-Lys388) of mouse IgE (Accession #) fused with and 6xHis tag at the C-t
- Immunogen:
- Pro50-Lys388
- Molekulargewicht:
- 45-75 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- PALGSELKVTTSQVTSWGKSAKNFTCHVTHPPSFNESRTILVRPVNITEPTLELLHSSCDPNAFHSTIQLYCFIYGHILNDVSVSWLMDDREITDTLAQTVLIKEEGKLASTCSKLNITEQQWMSESTFTCKVTSQGVDYLAHTRRCPDHEPRGVITYLIPPSPLDLYQNGAPKLTCLVVDLESEKNVNVTWNQEKKTSVSASQWYTKHHNNATTSITSILPVVAKDWIEGYGYQCIVDHPDFPKPIVRSITKTPGQRSAPEVYVFPPPEEESEDKRTLTCLIQNFFPEDISVQWLGDGKLISNSQHSTTTPLKSNGSNQGFFIFSRLEVAKTLWTQRK
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Isotype Controls
- Datenblatt des Herstellers:RPT0013