Recombinant Yeast sumo Protein
Produktgrößen
50 ug
£127,00
RPT0010-50UG
100 ug
£163,00
RPT0010-100UG
500 ug
£431,00
RPT0010-500UG
1000 ug
£622,00
RPT0010-1000UG
Über dieses Produkt
- SKU:
- RPT0010
- Zusätzliche Namen:
- sumo
- Konjugat:
- Biotin
- Weitere Details:
- Recombinant Yeast sumo Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Gly98) of yeast sumo (Accession #NP_010798.1) fused with with His tag at the N-terminal.
- Formulierung:
- Recombinant Yeast sumo Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Gly98) of yeast sumo (Accession #NP_010798.1) fused with with His tag at th
- Immunogen:
- Met1-Gly98
- Molekulargewicht:
- 15-20 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- MSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RPT0010