Recombinant Human IgG3 Protein
Produktgrößen
50 ug
£145,00
RPT0006-50UG
100 ug
£205,00
RPT0006-100UG
500 ug
£526,00
RPT0006-500UG
1000 ug
£812,00
RPT0006-1000UG
Über dieses Produkt
- SKU:
- RPT0006
- Zusätzliche Namen:
- IgG3,IGHG3,Immunoglobulin heavy constant gamma 3,Ig gamma-3 chain C region
- Weitere Details:
- IGHG3 (Immunoglobulin Heavy Constant Gamma 3 (G3m Marker), also known as IgG3) is a Protein Coding gene. Ig gamma-3 chain C region is a protein that in humans is encoded by the IGHG3 gene. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Murine immunoglobulin G (IgG) plays an important role in mediating protective immune responses to malaria. Diseases associated with IGHG3 include Heavy Chain Disease and Gamma Heavy Chain Disease. Among its related pathways are IL4-mediated signaling events and the Creation of C4 and C2 activators.
- Formulierung:
- Recombinant Human IgG3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu99-Lys377) of human IgG3 (Accession #) fused with no additional amino ac
- Immunogen:
- Glu99-Lys377
- Molekulargewicht:
- 35-45 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- ELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNAKTKPREEQYNSTFRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Isotype Controls
- Datenblatt des Herstellers:RPT0006