Recombinant Aequorea victoria EGFP Protein
Produktgrößen
20 ug
£145,00
RPT0003-20UG
50 ug
£193,00
RPT0003-50UG
100 ug
£276,00
RPT0003-100UG
500 ug
£764,00
RPT0003-500UG
1000 ug
£1193,00
RPT0003-1000UG
Über dieses Produkt
- SKU:
- RPT0003
- Zusätzliche Namen:
- Enhanced green fluorescent protein,EGFP
- Weitere Details:
- GFP, also known as Green Fluorescent Protein, is a protein produced by the jellyfish (Aequorea Victoria) that produces bioluminescence in the green zone of the noticeable spectrum. Green Fluorescent Protein is a useful and ubiquitous instrument for producing chimeric proteins, where it functions as a fluorescent protein tag. GFP is expressed in most known cell types and is used as a noninvasive fluorescent marker in living cells and organisms. Green Fluorescent Protein permits a broad range of applications where it has functioned as a cell lineage tracer, reporter of gene expression, or as a measure of protein-protein interactions. Enhanced GFP (eGFP) has F64L and S65T mutations, which make GFP show increased fluorescence and fold more efficiently under 37°C.
- Formulierung:
- Recombinant Aequorea victoria GFP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Lys238 (F64L,S65T)) of aequorea victoria GFP (Accession #)
- Immunogen:
- Met1-Lys238(F64L,S65T)
- Molekulargewicht:
- 22-30 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RPT0003