Recombinant Schistosoma japonicum GST-His Protein
Produktgrößen
100 ug
£163,00
RPT0002-100UG
500 ug
£431,00
RPT0002-500UG
1000 ug
£622,00
RPT0002-1000UG
Über dieses Produkt
- SKU:
- RPT0002
- Zusätzliche Namen:
- GST 26|Sj26 antigen|SjGST
- Weitere Details:
- Genetic engineers have used glutathione S-transferase to create the GST gene fusion system. This system is used to purify and detect proteins of interest. In a GST gene fusion system, the GST sequence is incorporated into an expression vector alongside the gene sequence encoding the protein of interest. Induction of protein expression from the vector's promoter results in expression of a fusion protein: the protein of interest fused to the GST protein. This GST-fusion protein can then be purified from cells via its high affinity for glutathione. GST is commonly used to create fusion proteins. The tag has the size of 22amino acids(roughly 26 KDa), which, compared to other tags like the Myc-or the FLAG-tag, is quite big. However, many commercially-available sources of GST-tagged plasmids include athrombindomain for cleavage of the GST tag during protein purification.
- Formulierung:
- Recombinant Schistosoma japonicum GST-His Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Lys218) of schistosoma japonicum GST-His fused with 6xHi
- Immunogen:
- Met1-Lys218
- Molekulargewicht:
- 25-35 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Datenblatt des Herstellers:RPT0002