Recombinant Schistosoma japonicum GST Protein
Produktgrößen
100 ug
£163,00
RPT0001-100UG
500 ug
£431,00
RPT0001-500UG
1000 ug
£622,00
RPT0001-1000UG
Über dieses Produkt
- SKU:
- RPT0001
- Zusätzliche Namen:
- GST, GST 26, Sj26 antigen, SjGST
- Weitere Details:
- GST isoenzymes appear to play a central role in the parasite detoxification system. Other functions are also suspected including a role in increasing the solubility of haematin in the parasite gut.
- Formulierung:
- Recombinant GST Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Lys218) of Schistosoma japonicum GST (Accession #P08515) fused with no tags.
- Immunogen:
- Met1-Lys218
- Molekulargewicht:
- 25-35 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Datenblatt des Herstellers:RPT0001