Recombinant Human IL-1 alpha Protein
Produktgrößen
10 ug
£145,00
RP03505-10UG
20 ug
£193,00
RP03505-20UG
50 ug
£288,00
RP03505-50UG
100 ug
£431,00
RP03505-100UG
500 ug
£1240,00
RP03505-500UG
1000 ug
£1954,00
RP03505-1000UG
Über dieses Produkt
- SKU:
- RP03505
- Zusätzliche Namen:
- IL1A, IL1F1, Interleukin-1 alpha, IL-1 alpha, Hematopoietin-1
- Weitere Details:
- The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease.
- Formulierung:
- Recombinant Human IL-1 alpha Protein is produced by E. coli Cells system. The target protein is expressed with sequence (Ser113-Ala271) of Human IL-1 alpha (Accession #NP_000566.3) fused with No tag .
- Immunogen:
- Ser113-Ala271
- Molekulargewicht:
- 15-20 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP03505