Recombinant Monkeypox virus M1R Protein
Produktgrößen
100 ug
£353,00
RP03292-100UG
500 ug
£1002,00
RP03292-500UG
1000 ug
£1954,00
RP03292-1000UG
Über dieses Produkt
- SKU:
- RP03292
- Zusätzliche Namen:
- M1R|Monkeypox virus M1R|MPXV M1R
- Weitere Details:
- Monkeypox virus (MPXV) is double-stranded DNA virus belonging to the genus orthopoxvirus that causes a smallpox-like disease in humans. M1R is homologous to the vaccinia virus L1 protein, a transmembrane protein found on the surface of mature IMV particles. And M1R is the component of the entry fusion complex (EFC), which consists of 11 proteins. During cell infection, this complex mediates entry of the virion core into the host cytoplasm by a two-step mechanism consisting of lipid mixing of the viral and cellular membranes and subsequent pore formation.
- Formulierung:
- Recombinant Monkeypox virus M1R Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly2-Gly183) of Monkeypox virus M1R (Accession #QJQ40223.1) fused
- Immunogen:
- Gly2-Gly183
- Molekulargewicht:
- 20-40 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
- Sequenz:
- MGAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNITVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGTGVQFYMIVIGVIILAALFMYYAKRMLFTSTNDKIKLILANKENVHWTTYMDTFFRTSPMIIATTDIQN
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP03292