Recombinant Human Inhibin beta E/INHBE Protein
Produktgrößen
20 ug
£193,00
RP03275-20UG
50 ug
£288,00
RP03275-50UG
100 ug
£431,00
RP03275-100UG
500 ug
£1240,00
RP03275-500UG
1000 ug
£1954,00
RP03275-1000UG
Über dieses Produkt
- SKU:
- RP03275
- Zusätzliche Namen:
- INHBE,Inhibin beta E chain, Activin beta-E chain
- Weitere Details:
- The INHBE protein is an important molecular switch that coordinates the inhibin and activin systems to regulate pituitary follicle-stimulating hormone secretion. Its critical role extends to multiple physiological functions, including hormone secretion, cell development, insulin release, and bone growth.
- Formulierung:
- Recombinant Human Inhibin beta E/INHBE Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr237-Ser350) of human Inhibin beta E/INHBE (Accession #NP
- Immunogen:
- Thr237-Ser350
- Molekulargewicht:
- 40-50 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- TPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP03275