Recombinant Human Calumenin/CALU Protein
Produktgrößen
50 ug
£526,00
RP03261-50UG
Über dieses Produkt
- SKU:
- RP03261
- Zusätzliche Namen:
- CALR|Calreticulin|cC1qR|CRP55|CRTC|ERp60|grp60|HACBP|HEL-S-99n|SSA
- Weitere Details:
- Calreticulin is a calcium-binding chaperone that promotes folding, oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Calreticulin reduces the binding of androgen receptor to its hormone-responsive DNA element and inhibits androgen receptor and retinoic acid receptor transcriptional activities in vivo, as well as retinoic acid-induced neuronal differentiation.
- Formulierung:
- Recombinant Human Calumenin/CALU Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Ala413) of Human Calumenin/CALU (Accession #P27797) fused wi
- Immunogen:
- Met1-Ala413
- Molekulargewicht:
- 55-60 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 90 %
- Sequenz:
- MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP03261