Recombinant Human NUDT5 Protein
Produktgrößen
100 ug
£395,00
RP03258-100UG
500 ug
£1157,00
RP03258-500UG
1000 ug
£2258,00
RP03258-1000UG
Über dieses Produkt
- SKU:
- RP03258
- Zusätzliche Namen:
- ADP-sugar pyrophosphatase|HSPC115|Nudix motif 5|NUDIX5|NUDT5|YSA1|YSA1H
- Weitere Details:
- NUDIX hydrolase type 5 (NUDT5) is a kind of ADP-ribose pyrophosphatase and nucleotide metabolizing enzyme that can either act as an ADP-sugar pyrophosphatase in absence of diphosphate or catalyze the synthesis of ATP in presence of diphosphate. In absence of diphosphate, NUDT5 hydrolyzes with similar activities various modified nucleoside diphosphates such as ADP-ribose, ADP-mannose, ADP-glucose, 8-oxo-GDP and 8-oxo-dGDP. In presence of diphosphate, NUDT5 mediates the synthesis of ATP in the nucleus by catalyzing the conversion of ADP-ribose to ATP and ribose 5-phosphate.
- Formulierung:
- Recombinant Human NUDT5 Protein is produced by E.coli expression system. The target protein is expressed with sequence (Met1-Phe219) of human NUDT5 (Accession #Q9UKK9) fused with His tag at the N-term
- Immunogen:
- Met1-Phe219
- Molekulargewicht:
- 30-35 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
- Sequenz:
- MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Datenblatt des Herstellers:RP03258