Recombinant Human NDRG1 Protein
Produktgrößen
100 ug
£431,00
RP03256-100UG
Über dieses Produkt
- SKU:
- RP03256
- Zusätzliche Namen:
- CAP43|CMT4D|Differentiation-related gene 1 protein|DRG1|GC4|HMSNL|N-myc downstream-regulated gene 1 protein|NDR1|NDRG1|NMSL|PROXY1|Reducing agents and tunicamycin-responsive protein|RIT42|RTP|TARG1|TDD5
- Weitere Details:
- NDRG1 is a cytoplasmic protein involved in stress responses, hormone responses, cell growth, and differentiation. NDRG1 is necessary for p53-mediated caspase activation and apoptosis. Mutations in the NDRG1 gene are a cause of Charcot-Marie-Tooth disease type 4D, and expression of this gene may be a prognostic indicator for several types of cancer.
- Formulierung:
- Recombinant Human NDRG1 Protein is produced by E.coli expression system. The target protein is expressed with sequence (Met1-Cys394) of human NDRG1 (Accession #Q92597) fused with His tag at the C-term
- Immunogen:
- Met1-Cys394
- Molekulargewicht:
- 40-45 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥85%
- Sequenz:
- MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP03256