Recombinant Human REG3G Protein
Produktgrößen
50 ug
£526,00
RP03255-50UG
Über dieses Produkt
- SKU:
- RP03255
- Zusätzliche Namen:
- Pancreatitis-associated protein 1B|PAP1B|REG-3-gamma|REG3G|Regenerating islet-derived protein 3-gamma
- Weitere Details:
- Regenerating islet-derived 3 gamma (REG3G), also known as pancreatitis-associated protein 1B (PAP1B), is a member of the secreted Reg superfamily and contains one typical C-type lectin domain. REG3G is expressed weakly in pancreas, strongly in intestinal tract, but not in hyperplastic islets REG3G might be a stress protein involved in the control of bacterial proliferation. It was indicated that REG3G specifically targets Gram-positive bacteria because it binds to their surface peptidoglycan layer, and serves as one of several antimicrobial peptides produced by paneth cells via stimulation of toll-like receptors (TLRs) by pathogen-associated molecular patterns (PAMPs).
- Formulierung:
- Recombinant Human REG3G Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Asp175) of human REG3G (Accession #Q6UW15) fused with His tag at the
- Immunogen:
- Met1-Asp175
- Molekulargewicht:
- 15-20 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- MLPPMALPSVSWMLLSCLILLCQVQGEETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKD
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Lectins
- Datenblatt des Herstellers:RP03255