Recombinant Mouse CXCL4/PF-4 Protein
Produktgrößen
10 ug
£133,00
RP03170-10UG
20 ug
£181,00
RP03170-20UG
50 ug
£240,00
RP03170-50UG
100 ug
£353,00
RP03170-100UG
500 ug
£1002,00
RP03170-500UG
1000 ug
£1574,00
RP03170-1000UG
Über dieses Produkt
- SKU:
- RP03170
- Zusätzliche Namen:
- Pf4, Cxcl4, Scyb4, Platelet factor 4, PF-4, C-X-C motif chemokine 4
- Weitere Details:
- Platelet factor-4 is a 70-amino acid protein that is released from the alpha-granules of activated platelets and binds with high affinity to heparin. Its major physiologic role appears to be neutralization of heparin-like molecules on the endothelial surface of blood vessels, thereby inhibiting local antithrombin III activity and promoting coagulation. As a strong chemoattractant for neutrophils and fibroblasts, PF4 probably has a role in inflammation and wound repair.
- Formulierung:
- Recombinant Mouse CXCL4/PF-4 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val30-Ser105) of Mouse CXCL4/PF-4 (Accession #NP_064316.1) fused with
- Immunogen:
- Val30-Ser105
- Molekulargewicht:
- 40-45 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 90% as determined by SDS-PAGE;≥ 90%
- Sequenz:
- VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP03170