Recombinant Mouse PDGF-AA Protein
Produktgrößen
50 ug
£574,00
RP03145-50UG
Über dieses Produkt
- SKU:
- RP03145
- Zusätzliche Namen:
- PDGF-A|PDGF1|PDGFA
- Weitere Details:
- Platelet-derived growth factor alpha (PDGFA) is frequently upregulated in various cancers and thought to function as a key player in the development and progression of tumor growth by regulating aspects of cell proliferation, angiogenesis and metastasis. The human platelet-derived growth factor A chain gene (PDGFA) on chromosome 7p22 encodes an important mitogen. Within PDGFA lies a complex minisatellite structure that results in partial duplications of exon 4 and the IVS4 splice donor site.
- Formulierung:
- Recombinant Mouse PDGF-AA Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ser87-Arg196) of Mouse PDGF-AA (Accession #NP_032834.1) fused with a 6xHis tag
- Immunogen:
- Ser87-Arg196
- Molekulargewicht:
- 20&26 KDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRR
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP03145